+46-31-212627
- Total 0 sek
PLA2G10 Secreted Phospholipase A2-X Human Recombinant Protein
Watch this product and we will notify you once it is back in stock.
PLA2G10 Secreted Phospholipase A2-X Human Recombinant Protein
Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).
MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ
PRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQE
LLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.
Size: 10ug
Source: E. Coli
Purity: Greater than 95% as determined by SDS PAGE.
Application: Cell Culture
Storage temperature: Store in -20°C for long term storage. After reconstitution, store in 4°C for short term usage within a few days. Avoid freeze-thaw cycles.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ
PRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQE
LLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.
Size: 10ug
Source: E. Coli
Purity: Greater than 95% as determined by SDS PAGE.
Application: Cell Culture
Storage temperature: Store in -20°C for long term storage. After reconstitution, store in 4°C for short term usage within a few days. Avoid freeze-thaw cycles.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.