+46-31-212627
- Total 0 sek
Anti-ZBTB7A Picoband&trade Antibody
Watch this product and we will notify you once it is back in stock.
Anti-ZBTB7A Picoband&trade Antibody
Rabbit Polyclonal ZBTB7A Antibody. Validated in IHC, WB and tested in Human. Size: 100&mug/vial.
Size: 100ug/vial
Source: Rabbit
Reactivity: Human
Purity: Immunogen affinity purified.
Application: IHC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ZBTB7A (125-163aa DLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEF), different from the related mouse sequence by eleven amino acids, and from the related rat sequence by ten amino acids.
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
Size: 100ug/vial
Source: Rabbit
Reactivity: Human
Purity: Immunogen affinity purified.
Application: IHC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ZBTB7A (125-163aa DLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEF), different from the related mouse sequence by eleven amino acids, and from the related rat sequence by ten amino acids.
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
MSDS skickas på Er begäran.