- 0 sek
Anti-TIM 1/HAVCR1 Antibody
Watch this product and we will notify you once it is back in stock.
Anti-TIM 1/HAVCR1 Antibody
Rabbit Polyclonal TIM 1/HAVCR1 Antibody. Validated in WB and tested in Human. Size: 100&mug/vial.
Size: 100ug/vial
Source: Rabbit
Reactivity: Human
Purity: Immunogen affinity purified.
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TIM 1 (321-359aa QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
Size: 100ug/vial
Source: Rabbit
Reactivity: Human
Purity: Immunogen affinity purified.
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TIM 1 (321-359aa QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
MSDS skickas på Er begäran.