- 0 sek
Anti-PKR/EIF2AK2 Picoband&trade Antibody
Watch this product and we will notify you once it is back in stock.
Anti-PKR/EIF2AK2 Picoband&trade Antibody
Rabbit Polyclonal PKR/EIF2AK2 Antibody. Validated in WB and tested in Human. Size: 100&mug/vial.
Size: 100ug/vial
Source: Rabbit
Reactivity: Human
Purity: Immunogen affinity purified.
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PKR(511-551aa EKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by thirteen amino acid
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
Size: 100ug/vial
Source: Rabbit
Reactivity: Human
Purity: Immunogen affinity purified.
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PKR(511-551aa EKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by thirteen amino acid
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
MSDS skickas på Er begäran.