- 0 sek
Anti-PITX2/RGS Picoband&trade Antibody
Watch this product and we will notify you once it is back in stock.
Anti-PITX2/RGS Picoband&trade Antibody
Rabbit IgG polyclonal antibody for PITX2/RGS detection. Tested with WB, FCM in HumanMouse.
Size: 100ug/vial
Reactivity: Mouse
Purity: Immunogen affinity purified.
Application: Flow Cytometry, WB
Immunogen: A synthetic peptide corresponding to a sequence of human PITX2/RGS (METNCRKLVSACVQLGVQPAAVECLFSKDSEIKK).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Mouse
Purity: Immunogen affinity purified.
Application: Flow Cytometry, WB
Immunogen: A synthetic peptide corresponding to a sequence of human PITX2/RGS (METNCRKLVSACVQLGVQPAAVECLFSKDSEIKK).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.