Anti-P Glycoprotein Antibody

Reactivity: Human, Mouse, Rat. No cross reactivity with other proteins.Clonality: PolyclonalImmunogen: A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA, different from the related rat sequence by twelve amino acids.Uniprot ID: P08183Application: IHC-P,IHC-FIg Type: Rabbit IgGVikt: 100ug

Storage temperature: At -20C for one year. After reconstitution, at 4C for one month. It can also be aliquotted and stored frozen at -20C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Cold Packs
Supplier: Bosterbio