+46-31-212627
- Total 0 sek
Anti-NKG2D/KLRK1 Picoband&trade Antibody
Watch this product and we will notify you once it is back in stock.
Anti-NKG2D/KLRK1 Picoband&trade Antibody
Rabbit Polyclonal NKG2D/KLRK1 Antibody. Validated in WB and tested in Mouse, Rat. Size: 100&mug/vial.
Size: 100ug/vial
Source: Rabbit
Reactivity: Mouse, Rat
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence of human NKG2D (YQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYH).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
Size: 100ug/vial
Source: Rabbit
Reactivity: Mouse, Rat
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence of human NKG2D (YQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYH).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
MSDS skickas på Er begäran.