- 0 sek
Anti-LOX-1/OLR1 Picoband&trade Antibody
Watch this product and we will notify you once it is back in stock.
Anti-LOX-1/OLR1 Picoband&trade Antibody
Rabbit Polyclonal LOX-1/OLR1 Antibody. Validated in WB and tested in Human. Size: 100ug/vial.
Size: 100ug/vial
Source: Rabbit
Reactivity: Human
Purity: Immunogen affinity purified.
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human LOX-1/OLR1 (162-197aa SFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISY), different from the related rat sequence by thirteen amino acids.
Clonality: Polyclonal
Storage temperature: At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
Size: 100ug/vial
Source: Rabbit
Reactivity: Human
Purity: Immunogen affinity purified.
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human LOX-1/OLR1 (162-197aa SFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISY), different from the related rat sequence by thirteen amino acids.
Clonality: Polyclonal
Storage temperature: At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
MSDS skickas på Er begäran.