Anti-KAT13D/CLOCK Antibody

Polyclonal antibody for KAT13D/CLOCK detection. Host: Rabbit.Size: 100g/vial. Tested applications: IHC-P. Reactive species: Human. KAT13D/CLOCK information: Molecular Weight: 95304 MW Subcellular Localization: Nucleus . Cytoplasm . Shuffling between the cytoplasm and the nucleus is under circadian regulation and is ARNTL/BMAL1-dependent. Phosphorylated form located in the nucleus while the nonphosphorylated form found only in the cytoplasm. Sequestered to the cytoplasm in the presence of ID2 (By similarity). Localizes to sites of DNA damage in a H2AX- independent manner Tissue Specificity: Hair follicles (at protein level). Expressed in all tissues examined including spleen, thymus, prostate, testis, ovary, small intestine, colon, leukocytes, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highest levels in testis and skeletal muscle. Low levels in thymus, lung and liver. Expressed in all brain regions with highest levels in cerebellum. Highly expressed in the suprachiasmatic nucleus (SCN).

Size: 100ug/vial
Source: Rabbit
Reactivity: Human, Mouse, Rat
Purity: Immunogen affinity purified.
Application: IHC, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human KAT13D/CLOCK (75-109aa QKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEE) , different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice

Delivery time: 2-14 days

Supplier: Bosterbio