- 0 sek
Anti-Hyaluronan synthase 1/HAS1 Picoband&trade Antibody
Watch this product and we will notify you once it is back in stock.
Anti-Hyaluronan synthase 1/HAS1 Picoband&trade Antibody
Rabbit IgG polyclonal antibody for Hyaluronan synthase 1/HAS1 detection. Tested with WB, IHC-P, IHC-F, ICC/IF, FCM in HumanMouseRat.
Size: 100ug/vial
Reactivity: Human, Mouse, Rat
Application: Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence of human HAS1 (NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA)
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human, Mouse, Rat
Application: Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence of human HAS1 (NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA)
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.