- 0 sek
Anti-Human SUR1 DyLight® 550 conjugated Antibody
Watch this product and we will notify you once it is back in stock.
Anti-Human SUR1 DyLight® 550 conjugated Antibody
Rabbit Polyclonal Human SUR1 DyLight® 550 conjugated Antibody. Validated in Flow Cytometry and tested in Human. Size: 100ug/vial.
Size: 100ug/vial
Reactivity: Human
Application: Flow Cytometry
Immunogen: A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA).
Clonality: Polyclonal
Storage temperature: At 2-8°C for one year. Protect from light. Do not freeze.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human
Application: Flow Cytometry
Immunogen: A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA).
Clonality: Polyclonal
Storage temperature: At 2-8°C for one year. Protect from light. Do not freeze.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.