- Total 0 sek
Anti-Hsp70 Picoband&trade Antibody (monoclonal, 3H5)

Watch this product and we will notify you once it is back in stock.
Anti-Hsp70 Picoband&trade Antibody (monoclonal, 3H5)
Mouse Monoclonal Hsp70 Antibody (monoclonal, 3H5). Validated in Flow Cytometry, IHC, ICC, WB and tested in Human, Mouse, Rat. Size: 100&mug/vial.
Size: 100ug/vial
Reactivity: Human, Mouse, Rat
Application: Flow Cytometry, IHC, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
Clonality: Monoclonal
Storage temperature: At -20℃ for one year. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human, Mouse, Rat
Application: Flow Cytometry, IHC, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
Clonality: Monoclonal
Storage temperature: At -20℃ for one year. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.