+46-31-212627
- Total 0 sek
Anti-HMGB1 Picoband&trade Antibody (monoclonal, 5H3)
Watch this product and we will notify you once it is back in stock.
Anti-HMGB1 Picoband&trade Antibody (monoclonal, 5H3)
Mouse IgG monoclonal antibody for HMGB1 detection. Tested with WB, IHC-P, FCM in HumanMouseRatMonkey.
Size: 100ug/vial
Reactivity: Human, Monkey, Mouse, Rat
Application: Flow Cytometry, IHC-P, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human, Monkey, Mouse, Rat
Application: Flow Cytometry, IHC-P, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.