- 0 sek
Anti-HMG4 Picoband&trade Antibody (monoclonal, 7G13)
Watch this product and we will notify you once it is back in stock.
Anti-HMG4 Picoband&trade Antibody (monoclonal, 7G13)
Mouse IgG monoclonal antibody for HMG4 detection. Tested with WB, IHC-P, ICC/IF, FCM in Human.
Size: 100ug/vial
Reactivity: Human
Purity: Immunogen affinity purified.
Application: Flow Cytometry, IF, IHC-P, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR), identical to the related mouse and rat sequences.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human
Purity: Immunogen affinity purified.
Application: Flow Cytometry, IF, IHC-P, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR), identical to the related mouse and rat sequences.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.