- Total 0 sek
Anti-FOXL2 antibody
![Anti-FOXL2 antibody](https://cdn.starwebserver.se/img/no-image.png)
Watch this product and we will notify you once it is back in stock.
Anti-FOXL2 antibody
Reactivity: Human, Mouse, Rat. No cross reactivity with other proteins.Clonality: PolyclonalImmunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FOXL281-113aa YQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFI, identical to the related rat and mouse sequences..Uniprot ID: P58012Application: WB,IHC-PIg Type: Rabbit IgGVikt: 100ug
Storage temperature: At -20C for one year. After reconstitution, at 4C for one month. It can also be aliquotted and stored frozen at -20C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Cold Packs
Supplier: Bosterbio
Storage temperature: At -20C for one year. After reconstitution, at 4C for one month. It can also be aliquotted and stored frozen at -20C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Cold Packs
Supplier: Bosterbio
MSDS skickas på Er begäran.