+46-31-212627
- Total 0 sek
Anti-EWSR1 Picoband&trade Antibody (monoclonal, 4B4)
Watch this product and we will notify you once it is back in stock.
Anti-EWSR1 Picoband&trade Antibody (monoclonal, 4B4)
Mouse Monoclonal EWSR1 Antibody (monoclonal, 4B4). Validated in IHC, WB and tested in Human, Monkey, Mouse. Size: 100&mug/vial.
Size: 100ug/vial
Reactivity: Human, Monkey, Mouse
Application: IHC, WB
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human, Monkey, Mouse
Application: IHC, WB
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.