Anti-E74 like factor 1/ELF1 Picoband&trade Antibody

Polyclonal antibody for E74 LIKE FACTOR 1/ELF1 detection. Host: Rabbit.Size: 100&mug/vial. Tested applications: WB. Reactive species: Human. E74 LIKE FACTOR 1/ELF1 information: Subcellular Localization: Nucleus Tissue Specificity: In fetal tissues, it is highly expressed in heart, lung liver and kidney, and weakly expressed in brain. In adult, it is highly expressed in pancreas, spleen, thymus and peripheral blood leukocytes, expressed at moderate levels in heart, placenta, lung, liver, skeletal muscle, kidney, prostate, ovary, small intestine and colon, and weakly expressed in brain and testis.

Size: 100ug/vial
Source: Rabbit
Reactivity: Human, Mouse, Rat
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence of human E74 like factor 1 (QPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDE).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice

Delivery time: 2-14 days

Supplier: Bosterbio