Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Monoclonal Antibody

Mouse Monoclonal Antibody Clone DG1/447 + DOG-1.1 antibody for DOG1/ANO1 detection. Host: Mouse.Size: 100ug/vial. Tested applications: IF. Reactive species: Human. DOG1/ANO1 information: Molecular Weight: 114078 MW Subcellular Localization: Cell membrane Multi-pass membrane protein. Cytoplasm. Cytoplasmic localization seen in neoplastic cells of head and neck squamous cell carcinoma (HNSCC) tumors Tissue Specificity: Broadly expressed with higher levels in liver, skeletal muscle and gastrointestinal muscles.

Size: 100ug/vial
Source: Mouse
Reactivity: Human
Application: IHC
Immunogen: Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).
Clonality: Monoclonal
Transport temperature: Shipped with wet ice

Supplier: Bosterbio