Anti-AMPK beta 2 Picoband&trade Antibody (monoclonal, 6G1)

Mouse Monoclonal AMPK beta 2 Antibody (monoclonal, 6G1). Validated in Flow Cytometry, IHC, ICC, WB and tested in Human. Size: 100&mug/vial.

Size: 100ug/vial
Reactivity: Human
Application: Flow Cytometry, IHC, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56-89aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
Clonality: Monoclonal
Storage temperature: At -20℃ for one year. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice

Supplier: Bosterbio