+46-31-212627
- Total 0 sek
Anti-ALDH2 Picoband&trade Antibody (monoclonal, 5G7)
Watch this product and we will notify you once it is back in stock.
Anti-ALDH2 Picoband&trade Antibody (monoclonal, 5G7)
Mouse IgG monoclonal antibody for ALDH2 detection. Tested with WB, FCM in HumanMouseRat.
Size: 100ug/vial
Reactivity: Human, Mouse, Rat
Application: Flow Cytometry, WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human, Mouse, Rat
Application: Flow Cytometry, WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.