+46-31-212627
- Total 0 sek
Anti-ACTN3 Picoband&trade Antibody (monoclonal, 9B5)
Watch this product and we will notify you once it is back in stock.
Anti-ACTN3 Picoband&trade Antibody (monoclonal, 9B5)
Mouse Monoclonal ACTN3 Antibody (monoclonal, 9B5). Validated in IHC, WB and tested in Mouse, Rat. Size: 100&mug/vial.
Size: 100ug/vial
Reactivity: Mouse, Rat
Application: IHC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Mouse, Rat
Application: IHC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.