Anti-TRAIL-R3 (human) Antibody

Goat Polyclonal TRAIL-R3 (human) Antibody. Validated in IF, WB and tested in Human. Size: 200µg.

Size: 200ug
Source: Goat
Reactivity: Human
Purity: Epitope-affinity purified IgG.
Application: IF, WB
Immunogen: Synthetic peptide corresponding to aa 33-63 (E³³VPQQTVAPQQQRHSFKGEECPAGSHRSEHT⁶³) of the extracellular domain of human TRAIL-R3.
Clonality: Polyclonal
Storage temperature: -20°C
Transport temperature: Shipped with wet ice

Supplier: Bosterbio