Anti-Toll-like Receptor 4 Antibody

Goat Polyclonal Toll-like Receptor 4 Antibody. Validated in IF, IHC and tested in Human, Mouse. Size: 200µg.

Size: 200ug
Source: Goat
Reactivity: Human, Mouse
Purity: Epitope-affinity purified IgG.
Application: IF, IHC
Immunogen: Synthetic peptide corresponding to aa 161-192 (L¹⁶¹IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC¹⁹²) of the N-terminal domain of human TLR4 (Toll-like receptor 4) .
Clonality: Polyclonal
Storage temperature: -20°C
Transport temperature: Shipped with wet ice

Supplier: Bosterbio