- 0 sek
Anti-TNF alpha Antibody
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-TNF alpha Antibody
Rabbit Polyclonal TNF alpha Antibody. Validated in IF, IHC-P, ICC, WB and tested in Human, Mouse, Rat. Size: 100&mug/vial.
Size: 100ug/vial
Reactivity: Human, Mouse, Rat
Purity: Immunogen affinity purified.
Application: IF, IHC-P, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TNF(201-233aa QLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL), different from the related mouse sequence by five amino acids, and rat sequence by seven amino acids.
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human, Mouse, Rat
Purity: Immunogen affinity purified.
Application: IF, IHC-P, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TNF(201-233aa QLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL), different from the related mouse sequence by five amino acids, and rat sequence by seven amino acids.
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.