- 0 sek
Anti-SMN1/2 Picoband&trade Antibody (monoclonal, 2B10)
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-SMN1/2 Picoband&trade Antibody (monoclonal, 2B10)
Mouse Monoclonal SMN1/2 Antibody (monoclonal, 2B10). Validated in IHC, ICC, WB and tested in Human, Mouse, Rat. Size: 100&mug/vial.
Size: 100ug/vial
Source: Mouse
Reactivity: Human, Mouse, Rat
Application: IHC, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SMN1/2(22-52aa RRGTGQSDDSDIWDDTALIKAYDKAVASFKH), identical to the related mouse and rat sequences.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
Size: 100ug/vial
Source: Mouse
Reactivity: Human, Mouse, Rat
Application: IHC, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SMN1/2(22-52aa RRGTGQSDDSDIWDDTALIKAYDKAVASFKH), identical to the related mouse and rat sequences.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
MSDS skickas på Er begäran.