Anti-SLC34A2 Picoband&trade Antibody

Rabbit Polyclonal SLC34A2 Antibody. Validated in Flow Cytometry, IHC-P, IHC-F, ICC, WB and tested in Human, Mouse, Rat. Size: 100&mug/vial.

Size: 100ug/vial
Reactivity: Human, Mouse, Rat
Purity: Immunogen affinity purified.
Application: Flow Cytometry, IHC-P, IHC-F, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence of human SLC34A2 (QNWTMKNVTYKENIAKCQHIFVNFHLPDLA).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice

Supplier: Bosterbio