Anti-SHP2/PTPN11 Picoband&trade Antibody (monoclonal, 2E6)

Mouse Monoclonal SHP2/PTPN11 Antibody (monoclonal, 2E6). Validated in Flow Cytometry, IF, IHC-P, ICC, WB and tested in Human, Mouse, Rat. Size: 100&mug/vial.

Size: 100ug/vial
Source: Rabbit IgG
Reactivity: Human, Mouse, Rat
Application: Flow Cytometry, IF, IHC-P, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK), identical to the related mouse and rat sequences.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice

Supplier: Bosterbio