+46-31-212627
- Totalt 0 sek
Anti-RHOB Picoband&trade Antibody
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-RHOB Picoband&trade Antibody
Rabbit Polyclonal RHOB Antibody. Validated in IHC-P, WB and tested in Human, Monkey. Size: 100&mug/vial.
Size: 100ug/vial
Source: Rabbit IgG
Reactivity: Human, Monkey
Application: IHC-P, WB
Immunogen: A synthetic peptide corresponding to a sequence of human RHOB(NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLE).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Source: Rabbit IgG
Reactivity: Human, Monkey
Application: IHC-P, WB
Immunogen: A synthetic peptide corresponding to a sequence of human RHOB(NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLE).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.