- 0 sek
Anti-nmt55 p54nrb Picoband&trade Antibody (monoclonal, 11E2)
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-nmt55 p54nrb Picoband&trade Antibody (monoclonal, 11E2)
Mouse Monoclonal nmt55 p54nrb Antibody (monoclonal, 11E2). Validated in Flow Cytometry, ICC, WB and tested in Human. Size: 100&mug/vial.
Size: 100ug/vial
Reactivity: Human
Application: Flow Cytometry, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55 p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ), identical to the related mouse and rat sequences.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human
Application: Flow Cytometry, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55 p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ), identical to the related mouse and rat sequences.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.