- 0 sek
Anti-NFIA Picoband&trade Antibody (monoclonal, 16H11)
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-NFIA Picoband&trade Antibody (monoclonal, 16H11)
Mouse Monoclonal NFIA Antibody (monoclonal, 16H11). Validated in Flow Cytometry, IHC-P, WB and tested in Human. Size: 100&mug/vial.
Size: 100ug/vial
Reactivity: Human
Application: Flow Cytometry, IHC-P, WB
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human
Application: Flow Cytometry, IHC-P, WB
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.