+46-31-212627
- Totalt 0 sek
Anti-Musashi 1/Msi1 Antibody (monoclonal, 2B9)
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-Musashi 1/Msi1 Antibody (monoclonal, 2B9)
Mouse IgG monoclonal antibody for Musashi 1/Msi1 detection. Tested with WB, IHC-P in Human.
Size: 100ug/vial
Reactivity: Human
Application: IHC-P, WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1 (21-54aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD), identical to the related mouse and rat sequences.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human
Application: IHC-P, WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1 (21-54aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD), identical to the related mouse and rat sequences.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.