+46-31-212627
- Totalt 0 sek
Anti-MRP1/ABCC1 Picoband&trade Antibody
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-MRP1/ABCC1 Picoband&trade Antibody
Rabbit Polyclonal MRP1/ABCC1 Antibody. Validated in WB and tested in Human. Size: 100ug/vial.
Size: 100ug/vial
Source: Rabbit
Reactivity: Human
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MRP1 (1493-1528aa DYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDA), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.
Clonality: Polyclonal
Storage temperature: At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
Size: 100ug/vial
Source: Rabbit
Reactivity: Human
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MRP1 (1493-1528aa DYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDA), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.
Clonality: Polyclonal
Storage temperature: At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
MSDS skickas på Er begäran.