Anti-LRIG3 Picoband&trade Antibody

Polyclonal antibody for LRIG3 detection. Host: Rabbit.Size: 100g/vial. Tested applications: WB. Reactive species: Human. LRIG3 information: Molecular Weight: 123434 MW Subcellular Localization: Cell membrane Single-pass type I membrane protein . Cytoplasmic vesicle membrane Single-pass type I membrane protein . Detected in cytoplasmic vesicles when coexpressed with ERBB4 Tissue Specificity: Widely expressed.

Size: 100ug/vial
Source: Rabbit
Reactivity: Human, Rat
Purity: Immunogen affinity purified.
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human LRIG3 (428-465aa NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ), different from the related mouse sequence by one amino acid.
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice

Delivery time: 2-14 days

Supplier: Bosterbio