Anti-IGFBP1 Picoband&trade Antibody

Rabbit Polyclonal IGFBP1 Antibody. Validated in ELISA, WB and tested in Mouse, Rat. Size: 100&mug/vial.

Size: 100ug/vial
Source: Rabbit
Reactivity: Mouse, Rat
Purity: Immunogen affinity purified.
Application: ELISA, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse IGFBP-1 (177-207aa REIADLKKWKEPCQRELYKVLERLAAAQQKA), different from the related human sequence by eleven amino acids, and from the related rat sequence by one amino acid.
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice

Delivery time: 2-14 days

Supplier: Bosterbio