- 0 sek
Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody(monoclonal, 2E7)
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody(monoclonal, 2E7)
Mouse Monoclonal Human TCP1 alpha DyLight® 550 conjugated Antibody(monoclonal, 2E7). Validated in Flow Cytometry and tested in Human. Size: 100ug/vial.
Size: 100ug/vial
Reactivity: Human
Application: Flow Cytometry
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Clonality: Monoclonal
Storage temperature: At 2-8°C for one year. Protect from light. Do not freeze.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human
Application: Flow Cytometry
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Clonality: Monoclonal
Storage temperature: At 2-8°C for one year. Protect from light. Do not freeze.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.