Anti-Human POR DyLight&reg 550 conjugated Antibody

Rabbit Polyclonal Human POR DyLight® 550 conjugated Antibody. Validated in Flow Cytometry and tested in Human. Size: 100ug/vial.

Size: 100ug/vial
Reactivity: Human
Application: Flow Cytometry
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human POR(633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK), different from the related mouse and rat sequences by five amino acids.
Clonality: Polyclonal
Storage temperature: At 2-8°C for one year. Protect from light. Do not freeze.
Transport temperature: Shipped with wet ice

Supplier: Bosterbio