- 0 sek
Anti-Human Hsp70 DyLight® 488 conjugated Antibody(monoclonal, 3H5)
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-Human Hsp70 DyLight® 488 conjugated Antibody(monoclonal, 3H5)
Mouse Monoclonal Human Hsp70 DyLight® 488 conjugated Antibody(monoclonal, 3H5). Validated in Flow Cytometry and tested in Human. Size: 100ug/vial.
Size: 100ug/vial
Reactivity: Human
Application: Flow Cytometry
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
Clonality: Monoclonal
Storage temperature: At 2-8°C for one year. Protect from light. Do not freeze.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human
Application: Flow Cytometry
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
Clonality: Monoclonal
Storage temperature: At 2-8°C for one year. Protect from light. Do not freeze.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.