- Totalt 0 sek
Anti-Human AMPK beta 2 DyLight® 550 conjugated Antibody(monoclonal, 6G1)
![Anti-Human AMPK beta 2 DyLight® 550 conjugated Antibody(monoclonal, 6G1)](https://cdn.starwebserver.se/img/no-image.png)
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-Human AMPK beta 2 DyLight® 550 conjugated Antibody(monoclonal, 6G1)
Mouse Monoclonal Human AMPK beta 2 DyLight® 550 conjugated Antibody(monoclonal, 6G1). Validated in Flow Cytometry and tested in Human. Size: 100ug/vial.
Size: 100ug/vial
Reactivity: Human
Application: Flow Cytometry
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56-89aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
Clonality: Monoclonal
Storage temperature: At 2-8°C for one year. Protect from light. Do not freeze.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human
Application: Flow Cytometry
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56-89aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
Clonality: Monoclonal
Storage temperature: At 2-8°C for one year. Protect from light. Do not freeze.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.