Anti-HOXB1 Picoband&trade Antibody

Rabbit Polyclonal HOXB1 Antibody. Validated in WB and tested in Human, Mouse, Rat. Size: 100ug/vial.

Size: 100ug/vial
Source: Rabbit
Reactivity: Human, Mouse, Rat
Purity: Immunogen affinity purified.
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HOXB1 (176-220aa TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK), different from the related mouse sequence by four amino acids.
Clonality: Polyclonal
Storage temperature: At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice

Delivery time: 2-14 days

Supplier: Bosterbio