- Totalt 0 sek
Anti-GABA Transporter 1/GAT 1/SLC6A1 Picoband&trade Antibody
![Anti-GABA Transporter 1/GAT 1/SLC6A1 Picoband&trade Antibody](https://cdn.starwebserver.se/img/no-image.png)
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-GABA Transporter 1/GAT 1/SLC6A1 Picoband&trade Antibody
Rabbit Polyclonal GABA Transporter 1/GAT 1/SLC6A1 Antibody. Validated in WB and tested in Human, Mouse, Rat. Size: 100ug/vial.
Size: 100ug/vial
Source: Rabbit
Reactivity: Human, Mouse, Rat
Purity: Immunogen affinity purified.
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC6A1 (23-54aa ANDKPKTLVVKVQKKAADLPDRDTWKGRFDFL), different from the related mouse and rat sequences by two amino acids.
Clonality: Polyclonal
Storage temperature: At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
Size: 100ug/vial
Source: Rabbit
Reactivity: Human, Mouse, Rat
Purity: Immunogen affinity purified.
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC6A1 (23-54aa ANDKPKTLVVKVQKKAADLPDRDTWKGRFDFL), different from the related mouse and rat sequences by two amino acids.
Clonality: Polyclonal
Storage temperature: At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
MSDS skickas på Er begäran.