- 0 sek
Anti-FOXA3 Picoband&trade Antibody
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-FOXA3 Picoband&trade Antibody
Rabbit Polyclonal FOXA3 Antibody. Validated in WB and tested in Human, Mouse, Rat. Size: 100&mug/vial.
Size: 100ug/vial
Source: Rabbit
Reactivity: Human, Mouse, Rat
Purity: Immunogen affinity purified.
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FOXA3 (291-324aa ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF), different from the related mouse and rat sequences by three amino acids.
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
Size: 100ug/vial
Source: Rabbit
Reactivity: Human, Mouse, Rat
Purity: Immunogen affinity purified.
Application: WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FOXA3 (291-324aa ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF), different from the related mouse and rat sequences by three amino acids.
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
MSDS skickas på Er begäran.