Anti-epithelial Sodium Channel alpha/SCNN1A Picoband&trade Antibody

Rabbit Polyclonal epithelial Sodium Channel alpha/SCNN1A Antibody. Validated in IF, ICC, WB and tested in Human, Mouse, Rat. Size: 100&mug/vial.

Size: 100ug/vial
Source: Rabbit
Reactivity: Human, Mouse, Rat
Application: IF, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence of human SCNN1A (QEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYK).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice

Delivery time: 2-14 days

Supplier: Bosterbio