- 0 sek
Anti-Emerin Picoband&trade Antibody (monoclonal, 5A10)
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-Emerin Picoband&trade Antibody (monoclonal, 5A10)
Mouse Monoclonal Emerin Antibody (monoclonal, 5A10). Validated in Flow Cytometry, IHC, ICC, WB and tested in Human. Size: 100&mug/vial.
Size: 100ug/vial
Source: Mouse
Reactivity: Human
Application: Flow Cytometry, IHC, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin (1-48aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino ac
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
Size: 100ug/vial
Source: Mouse
Reactivity: Human
Application: Flow Cytometry, IHC, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin (1-48aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino ac
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Delivery time: 2-14 days
Supplier: Bosterbio
MSDS skickas på Er begäran.