Anti-Cyclin T1/CCNT1 Picoband&trade Antibody

Rabbit Polyclonal Cyclin T1/CCNT1 Antibody. Validated in Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB and tested in Human, Mouse, Rat. Size: 100&mug/vial.

Size: 100ug/vial
Source: Rabbit
Reactivity: Human, Mouse, Rat
Purity: Immunogen affinity purified.
Application: Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Cyclin T1 (375-410aa QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM), different from the related mouse sequence by one amino acid.
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice

Delivery time: 2-14 days

Supplier: Bosterbio