- 0 sek
Anti-Cofilin 2/CFL2 Picoband&trade Antibody (monoclonal, 8C13)
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-Cofilin 2/CFL2 Picoband&trade Antibody (monoclonal, 8C13)
Mouse IgG monoclonal antibody for Cofilin 2/CFL2 detection. Tested with WB, IHC-P, ICC/IF, FCM in HumanMouseRat.
Size: 100ug/vial
Reactivity: Human, Mouse, Rat
Application: Flow Cytometry, IF, IHC-P, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cofilin 2/CFL2 (121-153aa KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL), identical to the related mouse sequence.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Reactivity: Human, Mouse, Rat
Application: Flow Cytometry, IF, IHC-P, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cofilin 2/CFL2 (121-153aa KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL), identical to the related mouse sequence.
Clonality: Monoclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.