+46-31-212627
- Totalt 0 sek
Anti-CD272/BTLA Picoband&trade Antibody
Lägg till en bevakning så meddelar vi dig så snart varan är i lager igen.
Anti-CD272/BTLA Picoband&trade Antibody
Rabbit Polyclonal CD272/BTLA Antibody. Validated in Flow Cytometry, IHC-P, IHC-F, ICC, WB and tested in Human, Mouse. Size: 100&mug/vial.
Size: 100ug/vial
Source: Rabbit IgG
Reactivity: Human, Mouse
Application: Flow Cytometry, IHC-P, IHC-F, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence of human CD272/BTLA (QSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRL).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
Size: 100ug/vial
Source: Rabbit IgG
Reactivity: Human, Mouse
Application: Flow Cytometry, IHC-P, IHC-F, ICC, WB
Immunogen: A synthetic peptide corresponding to a sequence of human CD272/BTLA (QSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRL).
Clonality: Polyclonal
Storage temperature: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Transport temperature: Shipped with wet ice
Supplier: Bosterbio
MSDS skickas på Er begäran.